PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr033457.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 272aa    MW: 31452.4 Da    PI: 9.3271
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr033457.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.95.7e-192370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+++v+ +G g+W+++ar  g++R +k+c++rw +yl
      Pbr033457.1 23 KGPWTAEEDRLLIEYVRVHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 70
                     79********************************************97 PP

2Myb_DNA-binding53.84.5e-1776120147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T+ E+ ++vd+++++G++ W+tIar ++ gRt++++k++w+++
      Pbr033457.1  76 RGQITPHEERIIVDLHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 120
                      7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.8161874IPR017930Myb domain
SuperFamilySSF466892.16E-3020117IPR009057Homeodomain-like
SMARTSM007171.1E-162272IPR001005SANT/Myb domain
PfamPF002492.2E-172370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-242477IPR009057Homeodomain-like
CDDcd001675.10E-122570No hitNo description
PROSITE profilePS5129419.76475125IPR017930Myb domain
SMARTSM007171.1E-1475123IPR001005SANT/Myb domain
PfamPF002491.1E-1376120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-2478124IPR009057Homeodomain-like
CDDcd001673.98E-1080121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MYLGMMAGHH MGWGLIEEEG WRKGPWTAEE DRLLIEYVRV HGEGRWNSVA RLAGLKRNGK  60
SCRLRWVNYL RPDLKRGQIT PHEERIIVDL HARWGNRWST IARSLPGRTD NEIKNYWRTH  120
FKKKAVKAPS DASEKAKNRL LRRQQFHQQQ QQQQQQQLRQ INQADVKKIM ALLDENDNNK  180
IPSCWSQVKL DSETSTTTTT VYPNTADQEQ GFFCSMLHGN VYMPEPASTN EDNYLWDGLW  240
NLDDIHGNFN TASACSTGKP SLLTNLVVPF Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-272312527128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341619.10.0PREDICTED: protein ODORANT1
TrEMBLM5XSD51e-139M5XSD5_PRUPE; Uncharacterized protein
STRINGGLYMA10G26681.11e-104(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.18e-86myb domain protein 305